1.67 Rating by CuteStat

marketsquarebooks.com is 7 years 3 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, marketsquarebooks.com is SAFE to browse.

PageSpeed Score
93
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

37.60.244.250

Hosted Country:

United States of America US

Location Latitude:

41.8797

Location Longitude:

-87.6435

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 37.60.244.250)

Steve Sasco designer of jewelry inspired by celebrities

- stevesascodesigns.com

Steve Sasco – Celebrity Jewelry Designer – Limited Editions. Unique jewelry items inspired by the celebrities who wear them!

Not Applicable $ 8.95

My Blog - My WordPress Blog

- beantoseattle.com
Not Applicable $ 8.95

EDssentials | Inspiration is Essential for EDucation

- edssentials.com
Not Applicable $ 8.95

SiteGround System Page Coming Soon

- ajmlandscaping.com
Not Applicable $ 8.95

SiteGround System Page Coming Soon

- bryanwilksharvardmasterdegree.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 25 Jan 2017 16:57:40 GMT
Content-Type: text/html
Content-Length: 11506
Connection: keep-alive
Last-Modified: Tue, 24 Jan 2017 04:47:31 GMT
ETag: "2cf2-546cfd05907e2"
Host-Header: 192fc2e7e50945beb8231a492d6a8024
X-Proxy-Cache: MISS
Accept-Ranges: bytes

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Jan 23, 2017, 12:00 AM 7 years 3 months 2 weeks ago
Last Modified: Jan 23, 2017, 12:00 AM 7 years 3 months 2 weeks ago
Expiration Date: Jan 23, 2019, 12:00 AM 5 years 3 months 2 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.us63.siteground.us 75.2.77.104 United States of America United States of America
ns2.us63.siteground.us 99.83.229.113 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
marketsquarebooks.com A 14395 IP: 37.60.244.250
marketsquarebooks.com NS 53614 Target: ns2.us63.siteground.us
marketsquarebooks.com NS 53614 Target: ns1.us63.siteground.us
marketsquarebooks.com SOA 86399 MNAME: ns1.us63.siteground.us
RNAME: dnsadmin.us63.siteground.us
Serial: 2017012303
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
marketsquarebooks.com MX 14399 Target: marketsquarebooks.com
marketsquarebooks.com TXT 14399 TXT: v=spf1 +a +mx +ip4:77.104.139.135
include:_spf.mailspamprotection.com ~all

Full WHOIS Lookup

Domain Name: marketsquarebooks.com
Registrar URL: http://www.godaddy.com
Registrant Name: Kevin Slimp
Registrant Organization:
Name Server: NS1.US63.SITEGROUND.US
Name Server: NS2.US63.SITEGROUND.US
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=marketsquarebooks.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.